Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Axin1 Rabbit Polyclonal Antibody (FITC)

Axin1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fu, Kb, Ki, Axin, fused, kinky, knobbly, AI316800

UniProt

O70239

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Axin1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TVGRDQALGARQAERPWPPHSHPSTPEPSVRNDGKRRFMGVRRQGSRGAG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

XP_920000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diamino-5-phenylthiazole Hydrobromide
TRC-D416590-5G 5 g

Diamino-5-phenylthiazole Hydrobromide

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF640R conjugate, 0.1mg/mL
BNC402558-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G,  30nm
GM-501-30 1 mL

Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G, 30nm

Sign In for Pricing
View Details
MRPS28 Rabbit Polyclonal Antibody
TA370747 100 µL

MRPS28 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STRIP2 (NM_020704) Human Recombinant Protein
TP314153M 100 µg

STRIP2 (NM_020704) Human Recombinant Protein

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), 1mg/mL
BNUM0014-50 1x 50 µL

CD31 / PECAM-1 (C31.7), 1mg/mL

Sign In for Pricing
View Details