Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtpbp10 Rabbit Polyclonal Antibody (FITC)

Gtpbp10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cldn12

UniProt

D4A3U1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Gtpbp10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094285

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal rpmH/L34 Antibody [mFluor Violet 500 SE]
NBP3-23516MFV500 0.1 mL

Rabbit Polyclonal rpmH/L34 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
HERC4 Protein Vector (Mouse) (pPM-C-HA)
PV188428 500 ng

HERC4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human PRM1 (Protamine 1) ELISA Kit
EH24353 96 Tests

Human PRM1 (Protamine 1) ELISA Kit

Sign In for Pricing
View Details
FHL2 antibody - C-terminal region (ARP34506_T100)
ARP34506_T100 100 µL

FHL2 antibody - C-terminal region (ARP34506_T100)

Sign In for Pricing
View Details
NEIL1 (Endonuclease 8-like 1, DNA Glycosylase/AP Lyase Neil1, DNA- (apurinic or apyrimidinic site) Lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei Homolog 1, NEH1, Nei-like Protein 1, FLJ22402) (MaxLight 490)
130265-ML490 100 µL

NEIL1 (Endonuclease 8-like 1, DNA Glycosylase/AP Lyase Neil1, DNA- (apurinic or apyrimidinic site) Lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei Homolog 1, NEH1, Nei-like Protein 1, FLJ22402) (MaxLight 490)

Sign In for Pricing
View Details
FGFR1 Human Over-expression Lysate
orb1376739 20 µg

FGFR1 Human Over-expression Lysate

Sign In for Pricing
View Details