Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtpbp10 Rabbit Polyclonal Antibody (HRP)

Gtpbp10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cldn12

UniProt

D4A3U1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Gtpbp10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094285

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD98/4F2hc Mouse Monoclonal Antibody
AG3241 50 µL

CD98/4F2hc Mouse Monoclonal Antibody

Sign In for Pricing
View Details
AASS (Aminoadipate Semialdehyde Synthase, LKR/SDH, LKRSDH, LORSDH, Saccharopine Dehydrogenase, Alpha-Aminoadipic Semialdehyde Synthase, Mitochondrial, Lysine Ketoglutarate Reductase)
361944 200 µL

AASS (Aminoadipate Semialdehyde Synthase, LKR/SDH, LKRSDH, LORSDH, Saccharopine Dehydrogenase, Alpha-Aminoadipic Semialdehyde Synthase, Mitochondrial, Lysine Ketoglutarate Reductase)

Sign In for Pricing
View Details
Arkadia CRISPR Activation Plasmid (m)
sc-430055-ACT 20 µg

Arkadia CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal LRRTM4 Antibody [Alexa Fluor 532]
NBP1-76530AF532 0.1 mL

Rabbit Polyclonal LRRTM4 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Mouse Monoclonal TFG Antibody (TFG-03) [DyLight 488]
NBP2-62212G 0.1 mL

Mouse Monoclonal TFG Antibody (TFG-03) [DyLight 488]

Sign In for Pricing
View Details
TST Blocking Peptide
33R-3229 100 ug

TST Blocking Peptide

Sign In for Pricing
View Details