Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCLN Rabbit Polyclonal Antibody (FITC)

OCLN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BLCPMG

UniProt

Q16625

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD39 full length protein-synthetic nanodisc
MBS189822-01 0.01 mg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CD39 full length protein-synthetic nanodisc
MBS189822-02 0.05 mg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CD39 full length protein-synthetic nanodisc
MBS189822-03 0.1 mg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Recombinant Shigella Boydii recR Protein (aa 1-201) (strain Sb227)
VAng-Lsx08779-500gEcoli 500 µg (E. coli)

Recombinant Shigella Boydii recR Protein (aa 1-201) (strain Sb227)

Sign In for Pricing
View Details
Lbp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
26332116 3x 1.0 µg

Lbp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Heparan sulfate (HS) Rat ELISA Kit
D9827 96 Tests

Heparan sulfate (HS) Rat ELISA Kit

Sign In for Pricing
View Details