Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCLN Rabbit Polyclonal Antibody (Biotin)

OCLN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BLCPMG

UniProt

Q16625

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF434 (Zinc Finger and SCAN Domain-Containing Protein 32, Human cervical Cancer Suppressor gene 5 Protein, HCCS-5, Zinc Finger Protein 434, ZSCAN32, ZNF434) (APC)
MBS6460574-01 0.2 mL

ZNF434 (Zinc Finger and SCAN Domain-Containing Protein 32, Human cervical Cancer Suppressor gene 5 Protein, HCCS-5, Zinc Finger Protein 434, ZSCAN32, ZNF434) (APC)

Sign In for Pricing
View Details
ZNF434 (Zinc Finger and SCAN Domain-Containing Protein 32, Human cervical Cancer Suppressor gene 5 Protein, HCCS-5, Zinc Finger Protein 434, ZSCAN32, ZNF434) (APC)
MBS6460574-02 5x 0.2 mL

ZNF434 (Zinc Finger and SCAN Domain-Containing Protein 32, Human cervical Cancer Suppressor gene 5 Protein, HCCS-5, Zinc Finger Protein 434, ZSCAN32, ZNF434) (APC)

Sign In for Pricing
View Details
KRT4 Rabbit Polyclonal Antibody (Biotin)
orb2091895 100 µL

KRT4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human OR4D9 qPCR Primer Pair
QH76097S 200 Tests

Human OR4D9 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Glycophorin A Antibody / Rabbit Monoclonal
V7275SAF-100UG 100 µg

Recombinant Glycophorin A Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details
PLKO.1-GLUD1 shRNA (3+1)
PPL01592-3 1 Each

PLKO.1-GLUD1 shRNA (3+1)

Sign In for Pricing
View Details