Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab13 Rabbit Polyclonal Antibody (FITC)

Rab13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

0610007N03Rik, B230212B15Rik

UniProt

Q9DD03

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAI26 AAV siRNA Pooled Vector
48095161 1.0 µg

TRNAI26 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human MFAP4 shRNA (UAS) - Lentiviral human MFAP4 shRNA (UAS, RFP) (25)
GTR15150659 1 Vial

Lentiviral human MFAP4 shRNA (UAS) - Lentiviral human MFAP4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Mu-01 96 Tests

Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit
RD-NPY1R-Mu-02 48 Tests

Mouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit

Sign In for Pricing
View Details
Rat Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1α) ELISA Kit
YP-W30422-01 48 Tests

Rat Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1α) ELISA Kit

Sign In for Pricing
View Details
Rat Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1α) ELISA Kit
YP-W30422-02 96 Tests

Rat Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1α) ELISA Kit

Sign In for Pricing
View Details