Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab13 Rabbit Polyclonal Antibody (HRP)

Rab13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

0610007N03Rik, B230212B15Rik

UniProt

Q9DD03

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7000-5p miRNA Antagomir
MBS8319998-01 10 nmol

mmu-miR-7000-5p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-7000-5p miRNA Antagomir
MBS8319998-02 20 nmol

mmu-miR-7000-5p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-7000-5p miRNA Antagomir
MBS8319998-03 5x 20 nmol

mmu-miR-7000-5p miRNA Antagomir

Sign In for Pricing
View Details
CHLI1 Antibody
PHY3306S 150 μg

CHLI1 Antibody

Sign In for Pricing
View Details
Porcine Tripartite Motif-Containing Protein 47 (TRIM47) ELISA Kit
MBS9937605-01 48 Well

Porcine Tripartite Motif-Containing Protein 47 (TRIM47) ELISA Kit

Sign In for Pricing
View Details
Porcine Tripartite Motif-Containing Protein 47 (TRIM47) ELISA Kit
MBS9937605-02 96 Well

Porcine Tripartite Motif-Containing Protein 47 (TRIM47) ELISA Kit

Sign In for Pricing
View Details