Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGN Rabbit Polyclonal Antibody (Biotin)

CGN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9P2M7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLERKVKELSI

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLERKVKELSI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

136 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_065821

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK 3 (IL-1 Receptor-associated Kinase 3) (AP) discontinued
I8600-16D-AP 100 µL

IRAK 3 (IL-1 Receptor-associated Kinase 3) (AP) discontinued

Sign In for Pricing
View Details
CK16 Rabbit Polyclonal Antibody
orb10402-01 50 μL

CK16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CK16 Rabbit Polyclonal Antibody
orb10402-02 100 µL

CK16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CK16 Rabbit Polyclonal Antibody
orb10402-03 200 µL

CK16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC2L6 (CDK19) Human Over-expression Lysate
orb1368652 20 µg

CDC2L6 (CDK19) Human Over-expression Lysate

Sign In for Pricing
View Details
RPL23AP40 3'UTR GFP Stable Cell Line
TU071103 1.0 mL

RPL23AP40 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details