Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP5 Rabbit Polyclonal Antibody (HRP)

MPP5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MPP5

UniProt

Q8N3R9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MPP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAGEA11 Polyclonal Antibody
TMAB-08516-01 50 μL

Anti-MAGEA11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MAGEA11 Polyclonal Antibody
TMAB-08516-02 100 µL

Anti-MAGEA11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MAGEA11 Polyclonal Antibody
TMAB-08516-03 200 µL

Anti-MAGEA11 Polyclonal Antibody

Sign In for Pricing
View Details
Complement Factor H (CFH, H Factor 1, HF, HF1, HF2, beta1 H-globulin, b1H Globulin) discontinued
C7850-82B 1 mg

Complement Factor H (CFH, H Factor 1, HF, HF1, HF2, beta1 H-globulin, b1H Globulin) discontinued

Sign In for Pricing
View Details
Human PTPRS (Protein Tyrosine Phosphatase Receptor Type S) ELISA Kit
EH26269 96 Tests

Human PTPRS (Protein Tyrosine Phosphatase Receptor Type S) ELISA Kit

Sign In for Pricing
View Details
Anti-CD58 Polyclonal Antibody
TMAB-04031-01 50 μL

Anti-CD58 Polyclonal Antibody

Sign In for Pricing
View Details