Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RADIL Rabbit Polyclonal Antibody (Biotin)

RADIL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RASIP2

UniProt

Q96JH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RADIL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Acetobutylicum apeB Protein (aa 1-433)
VAng-Lsx7414-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Acetobutylicum apeB Protein (aa 1-433)

Sign In for Pricing
View Details
FOLH1B Protein Vector (Human) (pPM-C-HA)
PV078695 500 ng

FOLH1B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human NPM3 sgRNA gene knockout kit - Lentiviral human NPM3 sgRNA gene knockout kit (100)
GTR15368404 1 Vial

Lentiviral human NPM3 sgRNA gene knockout kit - Lentiviral human NPM3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
(11Beta)-21-Omicron-Betaenzoyl-16,17-dihydro-17-deoxy Cortisol
TRC-B208115-5MG 5 mg

(11Beta)-21-Omicron-Betaenzoyl-16,17-dihydro-17-deoxy Cortisol

Sign In for Pricing
View Details
Human C-C motif chemokine 5 (CCL5) ELISA Kit
MBS284954-01 48 Tests

Human C-C motif chemokine 5 (CCL5) ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 5 (CCL5) ELISA Kit
MBS284954-02 96 Tests

Human C-C motif chemokine 5 (CCL5) ELISA Kit

Sign In for Pricing
View Details