Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RADIL Rabbit Polyclonal Antibody (HRP)

RADIL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RASIP2

UniProt

Q96JH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RADIL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Tau (Phosphorylated)(C5) Mouse IgG MoAb
JP11092E 10 µg

Anti-Human Tau (Phosphorylated)(C5) Mouse IgG MoAb

Sign In for Pricing
View Details
Cystatin C Mouse mAb (1H5)
E2250292 100 µL

Cystatin C Mouse mAb (1H5)

Sign In for Pricing
View Details
Complexin-2 CRISPR Activation Plasmid (h)
sc-406799-ACT 20 µg

Complexin-2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit
MBS2500160-01 24 Tests

Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit

Sign In for Pricing
View Details
Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit
MBS2500160-02 48 Tests

Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit

Sign In for Pricing
View Details
Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit
MBS2500160-03 96 Tests

Guinea pig DAP6 (Death Associated Protein 6) ELISA Kit

Sign In for Pricing
View Details