Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMOTL1 Rabbit Polyclonal Antibody (Biotin)

AMOTL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JEAP

UniProt

Q8IY63

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AMOTL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_570899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSEN2 Peptide - middle region (AAP97209)
AAP97209-100UG 100 µg

PSEN2 Peptide - middle region (AAP97209)

Sign In for Pricing
View Details
CDYL Rabbit Polyclonal Antibody
TA374606 100 µL

CDYL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Pvr protein, C-hFc-Avi Tag
IMP-336 20 µg

Recombinant Mouse Pvr protein, C-hFc-Avi Tag

Sign In for Pricing
View Details
Goat anti-Rabbit IgG (H&L), F (ab) '2 Fragment, DyLight® 488 conjugated
AS16 3527 0.5 mg

Goat anti-Rabbit IgG (H&L), F (ab) '2 Fragment, DyLight® 488 conjugated

Sign In for Pricing
View Details
Mas-related G-protein Coupled Receptor Member X1 (MAS-related GPR Member X1, MRGPRX1, MRGX1, Sensory Neuron-specific G-protein Coupled Receptor 3/4, SNSR3, SNSR4) discontinued
M2412-34 100 µg

Mas-related G-protein Coupled Receptor Member X1 (MAS-related GPR Member X1, MRGPRX1, MRGX1, Sensory Neuron-specific G-protein Coupled Receptor 3/4, SNSR3, SNSR4) discontinued

Sign In for Pricing
View Details
HRH2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6664R-BF555-TR 20 µL

HRH2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details