Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem178 Rabbit Polyclonal Antibody (FITC)

Tmem178 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tmem178a, 2810417M05Rik

UniProt

Q9CZ16

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem178

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF488A conjugate, 0.1mg/mL
BNC881775-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF280D Human Gene Knockout Kit (CRISPR)
KN415987 1 Kit

ZNF280D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429P-02 100 Tests

PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
KCNE1 (NM_001127669) Human Over-expression Lysate
LC426846 20 µg

KCNE1 (NM_001127669) Human Over-expression Lysate

Sign In for Pricing
View Details