Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem178 Rabbit Polyclonal Antibody (HRP)

Tmem178 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tmem178a, 2810417M05Rik

UniProt

Q9CZ16

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem178

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARHL1 (NM_020064) Human Recombinant Protein
TP320559M 100 µg

BARHL1 (NM_020064) Human Recombinant Protein

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF568 conjugate, 0.1mg/mL
BNC682836-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIR2DL4 (NM_002255) Human Over-expression Lysate
LC419420 20 µg

KIR2DL4 (NM_002255) Human Over-expression Lysate

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF640R conjugate, 0.1mg/mL
BNC402905-500 1x 500 µL

CD29 (Stem Cell Marker) (12G10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS506314 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
2,4-Dinitrobenzyl Bromide
TRC-D680470-1G 1 g

2,4-Dinitrobenzyl Bromide

Sign In for Pricing
View Details