Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INADL Rabbit Polyclonal Antibody (Biotin)

INADL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cipp, INADL, hINADL, InaD-like

UniProt

Q8NI35

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence DMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

NCBI Accession Number

NP_795352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rsl1 3'UTR Luciferase Stable Cell Line
TU118214 1.0 mL

Rsl1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TRNAN26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2509008 1.0 µg DNA

TRNAN26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MARCH9 Recombinant Protein (Human)
RP069966 100 µg

MARCH9 Recombinant Protein (Human)

Sign In for Pricing
View Details
CD49f, CT (ITGA6, Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD49f, Integrin alpha-6 heavy chain, Integrin alpha-6 light chain)
033521 200 µL

CD49f, CT (ITGA6, Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD49f, Integrin alpha-6 heavy chain, Integrin alpha-6 light chain)

Sign In for Pricing
View Details
STAT1, phosphorylated (Ser727) (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84) (MaxLight 750) discontinued
S7969-06D-ML750 100 µL

STAT1, phosphorylated (Ser727) (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CDKN1C Polyclonal Antibody, PE-Cy7 Conjugated
bs-0538R-PE-Cy7 100 µL

CDKN1C Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details