Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJP2 Rabbit Polyclonal Antibody (HRP)

TJP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZO2, X104, FHCA1, PFIC4, DFNA51, DUP9q21.11, C9DUPq21.11

UniProt

Q9UDY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TJP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARKD Protein Vector (Mouse) (pPM-C-HA)
15042025 500 ng

CARKD Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse constitutive androstane receptor (CAR) ELISA Kit
201-02-4421 96 Tests

Mouse constitutive androstane receptor (CAR) ELISA Kit

Sign In for Pricing
View Details
SLC17A4 Polyclonal Antibody, FITC Conjugated
A68204-050 50 µL

SLC17A4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
RBM12 Human shRNA Plasmid Kit (Locus ID 10137)
TR302082 1 Kit

RBM12 Human shRNA Plasmid Kit (Locus ID 10137)

Sign In for Pricing
View Details
Anti-SLC5A4 Rabbit pAb
GB115225-100 100 μL

Anti-SLC5A4 Rabbit pAb

Sign In for Pricing
View Details
Zenocutuzumab (Reference antibody)
E55B1233 100 µg

Zenocutuzumab (Reference antibody)

Sign In for Pricing
View Details