Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJP2 Rabbit Polyclonal Antibody (HRP)

TJP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZO2, X104, FHCA1, PFIC4, DFNA51, DUP9q21.11, C9DUPq21.11

UniProt

Q9UDY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TJP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NINJ1 Protein (N-human IgG1-Fc, Rat)
P527092 100 µg

NINJ1 Protein (N-human IgG1-Fc, Rat)

Sign In for Pricing
View Details
Lentiviral human HEATR4 shRNA (UAS) - Lentiviral human HEATR4 shRNA (UAS, iRFP) (100)
GTR15147183 1 Vial

Lentiviral human HEATR4 shRNA (UAS) - Lentiviral human HEATR4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PRMT2, CT (Protein Arginine N-Methyltransferase 2) (FITC) discontinued
P9004-10C-FITC 200 µL

PRMT2, CT (Protein Arginine N-Methyltransferase 2) (FITC) discontinued

Sign In for Pricing
View Details
Inos Antibody
orb806010 2 mg

Inos Antibody

Sign In for Pricing
View Details
SLC17A3 (Sodium-Dependent Phosphate Transport Protein 4, Solute Carrier Family 17 (Organic Anion Transporter), Member 3)
491865 100 µL

SLC17A3 (Sodium-Dependent Phosphate Transport Protein 4, Solute Carrier Family 17 (Organic Anion Transporter), Member 3)

Sign In for Pricing
View Details
ABI3BP Antibody
A48057-50UL 50 μL

ABI3BP Antibody

Sign In for Pricing
View Details