Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pex12 Rabbit Polyclonal Antibody (Biotin)

Pex12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O88177

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pex12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_446373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUPL2 Antibody
OACA03389-50UG 50 µg

NUPL2 Antibody

Sign In for Pricing
View Details
UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (MaxLight 405)
MBS6397858-01 0.1 mL

UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (MaxLight 405)

Sign In for Pricing
View Details
UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (MaxLight 405)
MBS6397858-02 5x 0.1 mL

UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (MaxLight 405)

Sign In for Pricing
View Details
Slc8a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4431302 1.0 µg DNA

Slc8a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
APC anti-mouse/rat CD61
GT01067 25 µg

APC anti-mouse/rat CD61

Sign In for Pricing
View Details
NPY4R/PPYR1 Antibody
orb1533042 50 µg

NPY4R/PPYR1 Antibody

Sign In for Pricing
View Details