Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pxmp3 Rabbit Polyclonal Antibody (HRP)

Pxmp3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PMP, Pxm, PAF-1, PMP35, Pxmp3, D3Ertd138, D3Ertd138e

UniProt

P55098

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GRP78 BiP Monoclonal Antibody
E-AB-81472-01 50 µL

Recombinant GRP78 BiP Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GRP78 BiP Monoclonal Antibody
E-AB-81472-02 100 µL

Recombinant GRP78 BiP Monoclonal Antibody

Sign In for Pricing
View Details
DDIT3 Recombinant Rabbit Monoclonal Antibody [JM10-31]
ET1703-05 100 µL

DDIT3 Recombinant Rabbit Monoclonal Antibody [JM10-31]

Sign In for Pricing
View Details
FRA1 Recombinant Rabbit Monoclonal Antibody [PSH06-95]
HA722771 100 µL

FRA1 Recombinant Rabbit Monoclonal Antibody [PSH06-95]

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL
BNCB2123-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PABIR3 activation kit by CRISPRa
GA115985 1 Kit

Human PABIR3 activation kit by CRISPRa

Sign In for Pricing
View Details