Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rag1 Rabbit Polyclonal Antibody (HRP)

Rag1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rag, Rag-1

UniProt

P15919

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033045

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (MaxLight 750)
MBS6231441-01 0.1 mL

ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (MaxLight 750)

Sign In for Pricing
View Details
ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (MaxLight 750)
MBS6231441-02 5x 0.1 mL

ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73) (MaxLight 750)

Sign In for Pricing
View Details
Human Gastrotropin (FABP6) ELISA Kit
abx570078 96 Well

Human Gastrotropin (FABP6) ELISA Kit

Sign In for Pricing
View Details
Polyclonal ATG16L1 / ATG16L Antibody (Internal)
APG02029G 0.05mg

Polyclonal ATG16L1 / ATG16L Antibody (Internal)

Sign In for Pricing
View Details
Dog IL17 (Interleukin 17) ELISA Kit
MBS8804725-01 48 Well

Dog IL17 (Interleukin 17) ELISA Kit

Sign In for Pricing
View Details
Dog IL17 (Interleukin 17) ELISA Kit
MBS8804725-02 96 Well

Dog IL17 (Interleukin 17) ELISA Kit

Sign In for Pricing
View Details