Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Rabbit Polyclonal Antibody (Biotin)

BARD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

F6MDH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human BARD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000456.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6H (NM_002347) Human Over-expression Lysate
LC419383 20 µg

LY6H (NM_002347) Human Over-expression Lysate

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 490)
MBS6205396-01 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 490)

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 490)
MBS6205396-02 5x 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 490)

Sign In for Pricing
View Details
GIMAP8, NT (GIMAP8, IAN9, IANT, GTPase IMAP family member 8, Immune-associated nucleotide-binding protein 9, Protein IanT) (APC)
MBS6302238-01 0.2 mL

GIMAP8, NT (GIMAP8, IAN9, IANT, GTPase IMAP family member 8, Immune-associated nucleotide-binding protein 9, Protein IanT) (APC)

Sign In for Pricing
View Details
GIMAP8, NT (GIMAP8, IAN9, IANT, GTPase IMAP family member 8, Immune-associated nucleotide-binding protein 9, Protein IanT) (APC)
MBS6302238-02 5x 0.2 mL

GIMAP8, NT (GIMAP8, IAN9, IANT, GTPase IMAP family member 8, Immune-associated nucleotide-binding protein 9, Protein IanT) (APC)

Sign In for Pricing
View Details
Anti-TIE2 Antibody-FITC (9U826)
TMAY-01088F-01 25 Tests

Anti-TIE2 Antibody-FITC (9U826)

Sign In for Pricing
View Details