Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Rabbit Polyclonal Antibody (HRP)

BARD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F6MDH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human BARD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000456.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit
MBS2087281-01 24 Strip Well

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit
MBS2087281-02 48 Well

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit
MBS2087281-03 96 Well

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit
MBS2087281-04 5x 96 Well

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit
MBS2087281-05 10x 96 Well

Pig Alpha-Fetoprotein (aFP) Mini Samples ELISA Kit

Sign In for Pricing
View Details
H2AFZ Conjugated Antibody
orb1619473 100 µL

H2AFZ Conjugated Antibody

Sign In for Pricing
View Details