Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Rabbit Polyclonal Antibody (HRP)

BARD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F6MDH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human BARD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000456.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H8 (NM_032494) Human Tagged ORF Clone
RC204522 10 µg

ZC3H8 (NM_032494) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)
RPU55859-01 50 µg

Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)

Sign In for Pricing
View Details
Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)
RPU55859-02 100 µg

Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)

Sign In for Pricing
View Details
Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)
RPU55859-03 1 mg

Recombinant Human Small Proline Rich Like Protein 4A (SPRL4A)

Sign In for Pricing
View Details
CNBD2 Protein Lysate
OCOA06778-20UG 20 µg

CNBD2 Protein Lysate

Sign In for Pricing
View Details
TLR7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46781064 1.0 µg DNA

TLR7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details