Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COP1 Rabbit Polyclonal Antibody (HRP)

COP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Co, Rfwd, Rfwd2, C80879, AI316802

UniProt

Q9R1A8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGTSQTKKQPW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036061

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GSK3 Beta (Phospho-Ser9) GSK3B Antibody
A00791S9-1 100 µL

Anti-GSK3 Beta (Phospho-Ser9) GSK3B Antibody

Sign In for Pricing
View Details
Prkci 3'UTR Luciferase Stable Cell Line
TU216779 1.0 mL

Prkci 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)
MBS1285893-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)
MBS1285893-02 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)
MBS1285893-03 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)
MBS1285893-04 0.1 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III 3-dehydroquinate dehydratase (aroD)

Sign In for Pricing
View Details