Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN17 Rabbit Polyclonal Antibody (Biotin)

TSPAN17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FBX23, FBXO23, TM4SF17

UniProt

Q96FV3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TSPAN17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0037414-01 24 Tests

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details
ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0037414-02 48 Tests

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details
ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0037414-03 96 Tests

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details
ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0037414-04 5x 96 Tests

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details
ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)
TRV-0037414-05 10x 96 Tests

ELISA Kit for Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 (CEACAM7)

Sign In for Pricing
View Details
Nickel Chloride Hexahydrate
41400001-3 500 g

Nickel Chloride Hexahydrate

Sign In for Pricing
View Details