Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rffl Rabbit Polyclonal Antibody (HRP)

Rffl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ca, fr, Car, rif, Carp2, BG080975, 1700051E09Rik, 4930516L10Rik

UniProt

Q3TEV8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEPSCKAC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI11C8]
CF813079 100 µg

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI11C8]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-,  20nm
GP-6701-20 1 mL

Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-, 20nm

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), Biotin conjugate, 0.1mg/mL
BNCB1634-500 1x 500 µL

P53 Tumor Suppressor Protein (PAb240), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triclabendazole Sulfone
TRC-T773825-10MG 10 mg

Triclabendazole Sulfone

Sign In for Pricing
View Details
GDNF Antibody
KC-728-01 50 μL

GDNF Antibody

Sign In for Pricing
View Details
GDNF Antibody
KC-728-02 100 µL

GDNF Antibody

Sign In for Pricing
View Details