Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC4 Rabbit Polyclonal Antibody (HRP)

HERC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5GLZ8

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human HERC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAV66578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF441 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2706606 1.0 µg DNA

ZNF441 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LCTL (NM_207338) Human Untagged Clone
SC308461 10 µg

LCTL (NM_207338) Human Untagged Clone

Sign In for Pricing
View Details
PTPN12 Polyclonal Antibody
orb1088805-01 100 µL

PTPN12 Polyclonal Antibody

Sign In for Pricing
View Details
PTPN12 Polyclonal Antibody
orb1088805-02 200 µL

PTPN12 Polyclonal Antibody

Sign In for Pricing
View Details
Human Delta Like Protein 3 (dLL3) ELISA Kit
EKL62391 96 Tests

Human Delta Like Protein 3 (dLL3) ELISA Kit

Sign In for Pricing
View Details
Chpt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4039006 1.0 µg DNA

Chpt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details