Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC4 Rabbit Polyclonal Antibody (HRP)

HERC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5GLZ8

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human HERC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAV66578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD7B sgRNA CRISPR Lentivector (Human) (Target 1)
K1579002 1.0 µg DNA

OTUD7B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HPPD CRISPR Activation Plasmid (m)
sc-420939-ACT 20 µg

HPPD CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Cfap61 (NM_175280) AAV Particle
MR220902A1V 250 µL

Mouse Cfap61 (NM_175280) AAV Particle

Sign In for Pricing
View Details
DOC4 shRNA (h) Lentiviral Particles
sc-40494-V 200 µL

DOC4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Cytokeratin Fragment Antigen 21-1 (CYFRA21-1) ELISA Kit
EIA05548Rb 1 Kit

Rabbit Cytokeratin Fragment Antigen 21-1 (CYFRA21-1) ELISA Kit

Sign In for Pricing
View Details
2, 3 Cyclic Nucleotide 3 Phosphohydrolase (CNP) Antibody
abx333933-01 20 µg

2, 3 Cyclic Nucleotide 3 Phosphohydrolase (CNP) Antibody

Sign In for Pricing
View Details