Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMFR Rabbit Polyclonal Antibody (FITC)

AMFR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GP78, RNF45

UniProt

Q9UKV5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AMFR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAH56869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD83/HB15 Protein (His Tag)
PKSR030224 100 µg

Recombinant Rat CD83/HB15 Protein (His Tag)

Sign In for Pricing
View Details
N-(Descarboxybenzofurane)-N-4-carboxy-3-hydroxybenzoyl Lifitegrast
TRC-C019485-10MG 10 mg

N-(Descarboxybenzofurane)-N-4-carboxy-3-hydroxybenzoyl Lifitegrast

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), CF594 conjugate, 0.1mg/mL
BNC940240-100 1x 100 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS800800 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit
RDR-AOC3-Mu-01 96 Tests

Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit
RDR-AOC3-Mu-02 48 Tests

Mouse Amine Oxidase, Copper Containing 3 (AOC3) ELISA Kit

Sign In for Pricing
View Details