Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D2 Rabbit Polyclonal Antibody (Biotin)

UBE2D2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2 (17) KB2

UniProt

P62837

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003330

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHE 3'UTR Luciferase Stable Cell Line
TU023136 1.0 mL

SHE 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Multiplex Assay Kit for Slit Homolog 2 (Slit2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026750 96 Tests

Multiplex Assay Kit for Slit Homolog 2 (Slit2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Recombinant Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3 (ND3)
orb2933575-01 20 µg

Recombinant Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3 (ND3)

Sign In for Pricing
View Details
Recombinant Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3 (ND3)
orb2933575-02 100 µg

Recombinant Platymonas subcordiformis NADH-ubiquinone oxidoreductase chain 3 (ND3)

Sign In for Pricing
View Details
Dulbecco's MEM (DMEM) High Glucose, w/ L-Glutamine, HEPES, Pyridoxal•HCl w/o Na Pyruvate
MBS652972-01 10 L

Dulbecco's MEM (DMEM) High Glucose, w/ L-Glutamine, HEPES, Pyridoxal•HCl w/o Na Pyruvate

Sign In for Pricing
View Details
Dulbecco's MEM (DMEM) High Glucose, w/ L-Glutamine, HEPES, Pyridoxal•HCl w/o Na Pyruvate
MBS652972-02 25 L

Dulbecco's MEM (DMEM) High Glucose, w/ L-Glutamine, HEPES, Pyridoxal•HCl w/o Na Pyruvate

Sign In for Pricing
View Details