Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D2 Rabbit Polyclonal Antibody (HRP)

UBE2D2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2 (17) KB2

UniProt

P62837

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2D2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003330

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG06F-PA/W 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Moesin (MSN/492), 1mg/mL
BNUM0492-50 1x 50 µL

Moesin (MSN/492), 1mg/mL

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF740 conjugate, 0.1mg/mL
BNC743339-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit
E-MSEL-M0046-01 24 Tests

Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit
E-MSEL-M0046-02 48 Tests

Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit
E-MSEL-M0046-03 96 Tests

Mini Sample Mouse IL-5 (Interleukin 5) ELISA Kit

Sign In for Pricing
View Details