Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D3 Rabbit Polyclonal Antibody (HRP)

UBE2D3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBC4/5, UBCH5C, E2 (17) KB3

UniProt

P61077

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003331

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Customized 5 Antibody
orb810804 2 mg

Customized 5 Antibody

Sign In for Pricing
View Details
Human SPARCL1 activation kit by CRISPRa
GA105551 1 Kit

Human SPARCL1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC1A6 Peptide - C-terminal region
MBS3232059-01 0.1 mg

SLC1A6 Peptide - C-terminal region

Sign In for Pricing
View Details
SLC1A6 Peptide - C-terminal region
MBS3232059-02 5x 0.1 mg

SLC1A6 Peptide - C-terminal region

Sign In for Pricing
View Details
Recombinant Treponema pallidum DNA translocase FtsK (ftsK)
orb2913161-01 20 µg

Recombinant Treponema pallidum DNA translocase FtsK (ftsK)

Sign In for Pricing
View Details
Recombinant Treponema pallidum DNA translocase FtsK (ftsK)
orb2913161-02 100 µg

Recombinant Treponema pallidum DNA translocase FtsK (ftsK)

Sign In for Pricing
View Details