Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR2/TGF-beta RII, Mouse (HEK293, His)

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.

Product Specifications

Product Name Alternative

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfbr2-tgf-beta-rii-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDHHHHHH

Molecular Formula

21813 (Gene_ID) Q62312-2 (I24-D159) (Accession)

Molecular Weight

25-38 kDa

References & Citations

[1]Busch S, et al. TGF-beta receptor type-2 expression in cancer-associated fibroblasts regulates breast cancer cell growth and survival and is a prognostic marker in pre-menopausal breast cancer. Oncogene. 2015 Jan 2;34 (1) :27-38.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial
RPC27210-01 20 µg

Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial

Sign In for Pricing
View Details
Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial
RPC27210-02 100 µg

Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial

Sign In for Pricing
View Details
Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial
RPC27210-03 1 mg

Recombinant Human Izumo sperm-egg fusion protein 1 (IZUMO1), partial

Sign In for Pricing
View Details
STEEL PADLOCK 38MM SHA KD BROWN/6 Keyed Padlocks & Safety Padlocks
814101 6 Box (6 Piece (s) x 1 Box)

STEEL PADLOCK 38MM SHA KD BROWN/6 Keyed Padlocks & Safety Padlocks

Sign In for Pricing
View Details
Grid2ip ORF Vector (Rat) (pORF)
22662016 1.0 µg DNA

Grid2ip ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ELISA Kit For Beta-2 adrenergic receptor
E9974b 96 Tests

ELISA Kit For Beta-2 adrenergic receptor

Sign In for Pricing
View Details