Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2h Rabbit Polyclonal Antibody (HRP)

Ube2h Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gid, Gid3, Ubc8, E2-20K, N28148, AI181839, AI326965, AI462483, AW227540, 1500009C23Rik

UniProt

P62257

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ube2h

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF8 Antibody
orb522140-01 50 μL

FGF8 Antibody

Sign In for Pricing
View Details
FGF8 Antibody
orb522140-02 100 µL

FGF8 Antibody

Sign In for Pricing
View Details
Moesin (MSN/492), CF647 conjugate, 0.1mg/mL
BNC470492-500 1x 500 µL

Moesin (MSN/492), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSC22D3 (NM_004089) Human Recombinant Protein
E45H37390M5 20 µg

TSC22D3 (NM_004089) Human Recombinant Protein

Sign In for Pricing
View Details
Gel Maker Stand
MT-G01 1 Unit

Gel Maker Stand

Sign In for Pricing
View Details
Recombinant Fiji disease virus Uncharacterized protein VP5 (S5), partial
MBS1383086 Inquire

Recombinant Fiji disease virus Uncharacterized protein VP5 (S5), partial

Sign In for Pricing
View Details