Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (FITC)

UBE2I Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB-BP Antibody
8C0161-AAT 50 µg

CREB-BP Antibody

Sign In for Pricing
View Details
Human DDX51 activation kit by CRISPRa
GA117326 1 Kit

Human DDX51 activation kit by CRISPRa

Sign In for Pricing
View Details
EASYStep Pro Human Immunoglobulin A (IgA) ELISA Kit
RDEp-IgA-Hu 96 Tests

EASYStep Pro Human Immunoglobulin A (IgA) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS622486 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
TNFRSF14 (NM_003820) Human Over-expression Lysate
LY401254 100 µg

TNFRSF14 (NM_003820) Human Over-expression Lysate

Sign In for Pricing
View Details
SCP3 Recombinant Rabbit Monoclonal Antibody [PSH02-24]
HA721804 100 µL

SCP3 Recombinant Rabbit Monoclonal Antibody [PSH02-24]

Sign In for Pricing
View Details