Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (HRP)

UBE2I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFN-β Antibody Pair Set
E-KAB-0035 50 µL & 100 µg

Human IFN-β Antibody Pair Set

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Rabbit IgG
FA-2307-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Rabbit IgG

Sign In for Pricing
View Details
Recombinant Human Endoglin/CD105 Protein (Fc Tag)
PKSH031832 50 µg

Recombinant Human Endoglin/CD105 Protein (Fc Tag)

Sign In for Pricing
View Details
HSP60 (LK1), Biotin conjugate, 0.1mg/mL
BNCB0851-500 1x 500 µL

HSP60 (LK1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (rAURKB/1592), CF647 conjugate, 0.1mg/mL
BNC473787-100 1x 100 µL

Aurora B (Proliferation Marker) (rAURKB/1592), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLI1 Human Gene Knockout Kit (CRISPR)
KN200695 1 Kit

FLI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details