Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (HRP)

UBE2I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP2 Human Gene Knockout Kit (CRISPR)
KN424842 1 Kit

TNFAIP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LOX Rabbit Polyclonal Antibody
TA373023 100 µL

LOX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM201 (NM_001010866) Human Over-expression Lysate
LC423194 20 µg

TMEM201 (NM_001010866) Human Over-expression Lysate

Sign In for Pricing
View Details
SNRPF Rabbit Polyclonal Antibody
TA381848 100 µL

SNRPF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G3]
TA505610BM 100 µL

CA12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G3]

Sign In for Pricing
View Details
ADSS1 (NM_152328) Human Recombinant Protein
TP308536M 100 µg

ADSS1 (NM_152328) Human Recombinant Protein

Sign In for Pricing
View Details