Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (HRP)

UBE2I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hdac7 ORF Vector (Mouse) (pORF)
ORF047045 1.0 µg DNA

Hdac7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
MBS1486586-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
MBS1486586-02 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
MBS1486586-03 1 mg (E-Coli)

Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
MBS1486586-04 5x 1 mg (E-Coli)

Recombinant Drosophila melanogaster (Fruit fly) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Sign In for Pricing
View Details
Human CD2AP Pre-designed siRNA Set A
SI002557A 1 Each

Human CD2AP Pre-designed siRNA Set A

Sign In for Pricing
View Details