Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (HRP)

UBE2I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEUROD6 Antibody
CSB-PA846677LA01HU-01 50 µg

NEUROD6 Antibody

Sign In for Pricing
View Details
NEUROD6 Antibody
CSB-PA846677LA01HU-02 100 µg

NEUROD6 Antibody

Sign In for Pricing
View Details
Dgat2 Rat Pre-designed siRNA Set A
HY-RS23092 1 Set

Dgat2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
EIF3l Antibody
orb805021 2 mg

EIF3l Antibody

Sign In for Pricing
View Details
TSC2, phosphorylated (S1096) (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (Biotin) discontinued
043343-Biotin 200 µL

TSC2, phosphorylated (S1096) (TSC2, TSC4, Tuberin, Tuberous sclerosis 2 protein) (Biotin) discontinued

Sign In for Pricing
View Details
Melanocortin Receptor 2, Mouse (MC2-R, ACTH-R, a-MSH Receptor, MSH Receptor) (Control Peptide)
M2868-11 100 µg

Melanocortin Receptor 2, Mouse (MC2-R, ACTH-R, a-MSH Receptor, MSH Receptor) (Control Peptide)

Sign In for Pricing
View Details