Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 Rabbit Polyclonal Antibody (FITC)

UBE2L3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E2-F1, L-UBC, UBCH7, UbcM4

UniProt

P68036

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003338

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [mFluor Violet 450 SE]
NBP2-47773MFV450 0.1 mL

Mouse Monoclonal TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PPARGC1B Rabbit Polyclonal Antibody
E10G12046 100 µL

PPARGC1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTND4P19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV735159 1.0 µg DNA

MTND4P19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
TLCD3B (NM_031478) Human Over-expression Lysate
LS083723-100ug 100 µg

TLCD3B (NM_031478) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human ULK2 shRNA (UAS) - Lentiviral human ULK2 shRNA (UAS, RFP) (100)
GTR15106176 1 Vial

Lentiviral human ULK2 shRNA (UAS) - Lentiviral human ULK2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit
orb1666646-01 48 Tests

Mouse Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit

Sign In for Pricing
View Details