Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKN Rabbit Polyclonal Antibody (FITC)

PRKN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P, Pa, Park2

UniProt

Q9WVS6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057903

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (MaxLight 405)
MBS6365881-01 0.1 mL

ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (MaxLight 405)

Sign In for Pricing
View Details
ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (MaxLight 405)
MBS6365881-02 5x 0.1 mL

ZNF214, NT (ZNF214, BAZ1, Zinc finger protein 214, BWSCR2-associated zinc finger protein 1) (MaxLight 405)

Sign In for Pricing
View Details
RASSF2 (NM_014737) Human Over-expression Lysate
LS009770-20ug 20 µg

RASSF2 (NM_014737) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Fbxw4 activation kit by CRISPRa
GA205271 1 Kit

Mouse Fbxw4 activation kit by CRISPRa

Sign In for Pricing
View Details
EVC Protein Lysate (Human) with C-Ha Tag
19540031 100 µg

EVC Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral human WDR97 sgRNA gene knockout kit - Lentiviral human WDR97 sgRNA gene knockout kit (25)
GTR15399054 1 Vial

Lentiviral human WDR97 sgRNA gene knockout kit - Lentiviral human WDR97 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details