Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFPL3 Rabbit Polyclonal Antibody (HRP)

RFPL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF120

UniProt

Q8N5R4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RFPL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_006595

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63-α Rabbit mAb
F0767-20ul 20 µL

P63-α Rabbit mAb

Sign In for Pricing
View Details
5HT3B receptor Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-4289R-BF350-01 20 µL

5HT3B receptor Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
5HT3B receptor Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-4289R-BF350-02 100 µL

5HT3B receptor Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ETV5 (Ets Variant 5, ERM) (MaxLight 405) discontinued
245849-ML405 100 µL

ETV5 (Ets Variant 5, ERM) (MaxLight 405) discontinued

Sign In for Pricing
View Details
OGG1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61557R-BF350-TR 20 µL

OGG1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Streptomyces lividans DNA-binding protein HU 1 polyclonal Antibody(hup1), FITC
MBS1496046-01 0.05 mg

Rabbit anti-Streptomyces lividans DNA-binding protein HU 1 polyclonal Antibody(hup1), FITC

Sign In for Pricing
View Details