Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWP2 Rabbit Polyclonal Antibody (HRP)

WWP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AIP2, WWp2-like

UniProt

O00308

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WWP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fkbpl Rat shRNA Plasmid (Locus ID 406168)
TL700459 1 Kit

Fkbpl Rat shRNA Plasmid (Locus ID 406168)

Sign In for Pricing
View Details
[KO Validated] Bcl-2 Rabbit pAb
E921592 100 µL

[KO Validated] Bcl-2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Mediator of RNA polymerase II transcription subunit 13 (srb9), partial
MBS1382293 Inquire

Recombinant Schizosaccharomyces pombe Mediator of RNA polymerase II transcription subunit 13 (srb9), partial

Sign In for Pricing
View Details
PPIL1 (Peptidylprolyl Isomerase (cyclophilin)-like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 490)
MBS6208016-01 0.1 mL

PPIL1 (Peptidylprolyl Isomerase (cyclophilin)-like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 490)

Sign In for Pricing
View Details
PPIL1 (Peptidylprolyl Isomerase (cyclophilin)-like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 490)
MBS6208016-02 5x 0.1 mL

PPIL1 (Peptidylprolyl Isomerase (cyclophilin)-like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 490)

Sign In for Pricing
View Details
3-Chloro-4-fluorobenzoic Acid 98%
C12694-01 1 g

3-Chloro-4-fluorobenzoic Acid 98%

Sign In for Pricing
View Details