Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2C Rabbit Polyclonal Antibody (HRP)

UBE2C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBCH10, dJ447F3.2

UniProt

O00762

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chromodomain Y-like protein (CDYL) ELISA Kit
MBS7253544-01 48 Well

Mouse Chromodomain Y-like protein (CDYL) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromodomain Y-like protein (CDYL) ELISA Kit
MBS7253544-02 96 Well

Mouse Chromodomain Y-like protein (CDYL) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromodomain Y-like protein (CDYL) ELISA Kit
MBS7253544-03 5x 96 Well

Mouse Chromodomain Y-like protein (CDYL) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromodomain Y-like protein (CDYL) ELISA Kit
MBS7253544-04 10x 96 Well

Mouse Chromodomain Y-like protein (CDYL) ELISA Kit

Sign In for Pricing
View Details
ARHGAP22 shRNA (m) Lentiviral Particles
sc-141209-V 200 µL

ARHGAP22 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
hsa-miR-210-5p miRNA Antagomir
MBS8317980-01 10 nmol

hsa-miR-210-5p miRNA Antagomir

Sign In for Pricing
View Details