Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxl3 Rabbit Polyclonal Antibody (HRP)

Fbxl3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ov, FBK, Fbl, Pla, Fbxl, Ovtm, Fbl3a, Fbxl3a, Play68, AU041772, AW212966

UniProt

Q8C4V4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automatic Lubricating Oils Oxidation Stability Tester (Rotating pressure vessel method) (Metal bath BPTL-268
BPTL-268 1 Unit

Automatic Lubricating Oils Oxidation Stability Tester (Rotating pressure vessel method) (Metal bath BPTL-268

Sign In for Pricing
View Details
4921539E11Rik Mouse Gene Knockout Kit (CRISPR)
KN500348 1 Kit

4921539E11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NXF2 (NM_022053) Human Over-expression Lysate
LY402901 100 µg

NXF2 (NM_022053) Human Over-expression Lysate

Sign In for Pricing
View Details
Septin 3 (SEPT3) (NM_145733) Human Recombinant Protein
TP315771 20 µg

Septin 3 (SEPT3) (NM_145733) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant TAK1 Antibody
RC-15651-01 50 μL

Recombinant TAK1 Antibody

Sign In for Pricing
View Details
Recombinant TAK1 Antibody
RC-15651-02 100 µL

Recombinant TAK1 Antibody

Sign In for Pricing
View Details