Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Rabbit Polyclonal Antibody (Biotin)

FBXO2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FBG1, FBX2, Fbs1, OCP1, NFB42

UniProt

Q9UK22

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FBXO2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036300

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTB, CT (LTB, TNFC, TNFSF3, Lymphotoxin-beta, Tumor necrosis factor C, Tumor necrosis factor ligand superfamily member 3)
MBS6002558-01 0.2 mL

LTB, CT (LTB, TNFC, TNFSF3, Lymphotoxin-beta, Tumor necrosis factor C, Tumor necrosis factor ligand superfamily member 3)

Sign In for Pricing
View Details
LTB, CT (LTB, TNFC, TNFSF3, Lymphotoxin-beta, Tumor necrosis factor C, Tumor necrosis factor ligand superfamily member 3)
MBS6002558-02 5x 0.2 mL

LTB, CT (LTB, TNFC, TNFSF3, Lymphotoxin-beta, Tumor necrosis factor C, Tumor necrosis factor ligand superfamily member 3)

Sign In for Pricing
View Details
CD103 mouse monoclonal antibody, clone OX-62, PE
SM299R 100 Tests

CD103 mouse monoclonal antibody, clone OX-62, PE

Sign In for Pricing
View Details
Mouse Anti-Human Fli-1 monoclonal antibody, clone JID687
CABT-L2815-01 100 µl, 500 µl

Mouse Anti-Human Fli-1 monoclonal antibody, clone JID687

Sign In for Pricing
View Details
Mouse Anti-Human Fli-1 monoclonal antibody, clone JID687
CABT-L2815-02 100 uL, 500 uL

Mouse Anti-Human Fli-1 monoclonal antibody, clone JID687

Sign In for Pricing
View Details
Rabbit Monoclonal Transthyretin/Prealbumin Antibody (003) [Alexa Fluor 594]
NBP2-90050AF594 0.1 mL

Rabbit Monoclonal Transthyretin/Prealbumin Antibody (003) [Alexa Fluor 594]

Sign In for Pricing
View Details