Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO2 Rabbit Polyclonal Antibody (HRP)

FBXO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBG1, FBX2, Fbs1, OCP1, NFB42

UniProt

Q9UK22

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FBXO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036300

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV692836 1.0 µg DNA

STX4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse St6gal1 Pre-designed siRNA Set B
SI113895B 1 Each

Mouse St6gal1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Bovine Interferon gamma ELISA Kit
orb561315-01 48 Tests

Bovine Interferon gamma ELISA Kit

Sign In for Pricing
View Details
Bovine Interferon gamma ELISA Kit
orb561315-02 96 Tests

Bovine Interferon gamma ELISA Kit

Sign In for Pricing
View Details
PPX Monoclonal Antibody
JOT-MCA1055-01 20 µL

PPX Monoclonal Antibody

Sign In for Pricing
View Details
PPX Monoclonal Antibody
JOT-MCA1055-02 50 μL

PPX Monoclonal Antibody

Sign In for Pricing
View Details