Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKRN2 Rabbit Polyclonal Antibody (HRP)

MKRN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF62, HSPC070

UniProt

Q9H000

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MKRN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054879

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZC3H11A Antibody [DyLight 350]
NB100-74650UV 0.1 mL

Rabbit Polyclonal ZC3H11A Antibody [DyLight 350]

Sign In for Pricing
View Details
Smagp (NM_174992) Mouse Recombinant Protein
TP500283 20 µg

Smagp (NM_174992) Mouse Recombinant Protein

Sign In for Pricing
View Details
PIGO Antibody (C-term)
E45M07171G-4 50 µL

PIGO Antibody (C-term)

Sign In for Pricing
View Details
DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750)
MBS6232567-01 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750)

Sign In for Pricing
View Details
DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750)
MBS6232567-02 5x 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750)

Sign In for Pricing
View Details
9-Undecynoic Acid Ethyl Ester
440483-01 50 mg

9-Undecynoic Acid Ethyl Ester

Sign In for Pricing
View Details