Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKRN2 Rabbit Polyclonal Antibody (HRP)

MKRN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF62, HSPC070

UniProt

Q9H000

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MKRN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054879

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMUBP2 (IGHMBP2) (NM_002180) Human Tagged Lenti ORF Clone
RC211261L3 10 µg

SMUBP2 (IGHMBP2) (NM_002180) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ADRA1D sgRNA CRISPR Lentivector set (Human)
K0052301 3x 1.0 µg

ADRA1D sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Krt19 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3934202 1.0 µg DNA

Krt19 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
POLR2B Peptide
MBS3225985-01 0.1 mg

POLR2B Peptide

Sign In for Pricing
View Details
POLR2B Peptide
MBS3225985-02 5x 0.1 mg

POLR2B Peptide

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (5, 6 dihydroxyindole 2 carboxylic acid oxidase, 6-dihydroxyindole-2-carboxylic acid oxidase, Associated with iris pigmentation, CAS2, Catalase B, CATB, DHICA oxidase, GlycoProtein75, GP75, Melanoma antigen gp75, Tyrosinase-re
MBS6124560-01 0.1 mL

Tyrosinase-Related Protein-1 (5, 6 dihydroxyindole 2 carboxylic acid oxidase, 6-dihydroxyindole-2-carboxylic acid oxidase, Associated with iris pigmentation, CAS2, Catalase B, CATB, DHICA oxidase, GlycoProtein75, GP75, Melanoma antigen gp75, Tyrosinase-re

Sign In for Pricing
View Details