Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF364 Rabbit Polyclonal Antibody (Biotin)

ZNF364 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BCA2, ZNF364

UniProt

Q9Y4L5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF364

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1 Mouse Monoclonal Antibody [1F2]
EM1707-60 100 µL

PD1 Mouse Monoclonal Antibody [1F2]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY,  5nm
GAF-2354-5 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Chicken IgY, 5nm

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), Biotin conjugate, 0.1mg/mL
BNCB0950-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NF2 pSer518 Rabbit Polyclonal Antibody
AP20869PU-N 100 µg

NF2 pSer518 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD272 Antibody[6F7]
AN00415UD-01 25 µg

PE Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details
PE Anti-Mouse CD272 Antibody[6F7]
AN00415UD-02 100 µg

PE Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details